ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV0876.2   suspect: LH  OPR   KOG2195   General function prediction only                               Transferrin receptor and related proteins containing the protease-associated (PA) domain
r_klactIV0876.2   suspect: LH  OPR   KOG2195   Inorganic ion transport and metabolism                         Transferrin receptor and related proteins containing the protease-associated (PA) domain
r_klactIV0876.2   suspect: LH  OPR   KOG2195   Posttranslational modification, protein turnover, chaperones   Transferrin receptor and related proteins containing the protease-associated (PA) domain

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV0876.2 286285 286148 -46  
         (46 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Hs4885505 [OPR] KOG2195 Transferrin receptor and related protein...    26   9.2  

>Hs4885505 [OPR] KOG2195 Transferrin receptor and related proteins containing
           the protease-associated (PA) domain
          Length = 740

 Score = 26.2 bits (56), Expect = 9.2
 Identities = 10/31 (32%), Positives = 18/31 (57%)

Query: 4   VLELSWNTPTTGWVGQLEWPQEVVGLLEVRT 34
           ++  SW+    G +G  EW +E V +L+ R+
Sbjct: 406 IIFASWDAEEFGLLGSTEWAEENVKILQERS 436


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.315    0.135    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,958,170
Number of Sequences: 60738
Number of extensions: 75299
Number of successful extensions: 90
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 89
Number of HSP's gapped (non-prelim): 1
length of query: 46
length of database: 30,389,216
effective HSP length: 22
effective length of query: 24
effective length of database: 29,052,980
effective search space: 697271520
effective search space used: 697271520
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)