ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV0969 suspect: LH S KOG4643 Function unknown Uncharacterized coiled-coil protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV0969  320199  320528 110  
         (110 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs8923838 [S] KOG4643 Uncharacterized coiled-coil protein 46 7e-06 >Hs8923838 [S] KOG4643 Uncharacterized coiled-coil protein Length = 742 Score = 46.2 bits (108), Expect = 7e-06 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 8/94 (8%) Query: 5 RTTELEGDLAQLTYELGLKDKEVMTLK---QSLERLNAEVEKLRNENRGLKSELEHWNKL 61 R ELE +L L E L K++ LK + +E L E +L ENR LK L+ + L Sbjct: 551 RAEELENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNL 610 Query: 62 PMSPISLSSENDQTEDDKNRMIQENLRREILSLK 95 SL EN Q +++ LRR + SLK Sbjct: 611 TFQLESLEKENSQLDEE-----NLELRRNVESLK 639 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.308 0.127 0.334 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,898,994 Number of Sequences: 60738 Number of extensions: 221541 Number of successful extensions: 1857 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1853 Number of HSP's gapped (non-prelim): 4 length of query: 110 length of database: 30,389,216 effective HSP length: 86 effective length of query: 24 effective length of database: 25,165,748 effective search space: 603977952 effective search space used: 603977952 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)