ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV1481 suspect: LH U KOG3838 Intracellular trafficking, secretion, and vesicular transport Mannose lectin ERGIC-53, involved in glycoprotein traffic

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV1481 502506  503816 437  
         (437 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7295074 [U] KOG3838 Mannose lectin ERGIC-53 involved in glycopro... 54 4e-07 >7295074 [U] KOG3838 Mannose lectin ERGIC-53 involved in glycoprotein traffic Length = 512 Score = 54.3 bits (129), Expect = 4e-07 Identities = 52/218 (23%), Positives = 84/218 (37%), Gaps = 33/218 (15%) Query: 44 PDLVHMNAVPSDWKTSXXXXXXXXXXXXTPSASSQS-SIWHKTDYQIKDSFTIEWTFRSV 102 P L + W+ PS SQ +IW K+ D + +E FR Sbjct: 44 PYLAQKDGTVPFWEYGGNAIASSESVRVAPSLRSQKGAIWTKSQTNF-DWWDVEIVFRVT 102 Query: 103 DFIGKSEGGLSFWLVEGKSAGGTSLFGGPEAFDGLQILVDS----NGPVGSSVRGILNDG 158 GL+FW K +FG + ++GL I+ DS N + +LNDG Sbjct: 103 GRGRIGADGLAFWYTTEKGDYNGPVFGSSDRWNGLAIMFDSFDNDNKHNNPYISAVLNDG 162 Query: 159 SKKLTEKNVYDHS-------FAYCLLAYQDTTIPTTIRLSYDRKNNNLLKLQVDN----- 206 +K +YDH+ + CL +++ PT R+ Y NN+L + + N Sbjct: 163 TK------LYDHAEDGTTQLLSGCLRDFRNKPFPTRARIEY---YNNVLTVMIHNGMSNN 213 Query: 207 ----RVCFQTRQIQFPQNAKMKMGITAKNDANKESFEV 240 +C + + P+N GI+A + +V Sbjct: 214 NDDYELCLRADGVNLPKNG--YFGISAATGGLADDHDV 249 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,830,017 Number of Sequences: 60738 Number of extensions: 995069 Number of successful extensions: 2713 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2712 Number of HSP's gapped (non-prelim): 2 length of query: 437 length of database: 30,389,216 effective HSP length: 109 effective length of query: 328 effective length of database: 23,768,774 effective search space: 7796157872 effective search space used: 7796157872 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)