ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV1680   suspect: LH   B     KOG4012  Chromatin structure and dynamics                               Histone H1

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV1680 582091  582312 74   
         (74 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YPL127c [B] KOG4012 Histone H1                                         52   1e-07

>YPL127c [B] KOG4012 Histone H1
          Length = 258

 Score = 52.4 bits (124), Expect = 1e-07
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 3/50 (6%)

Query: 26 ELITEAIVALAERGGSSRQALKSFIKEKYPV---GENFDTQFNLAVQERV 72
          ELI E + AL ER GSSR ALK FIKE YP+     NFD  FN A+++ V
Sbjct: 49 ELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGV 98


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.322    0.137    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,215,215
Number of Sequences: 60738
Number of extensions: 77589
Number of successful extensions: 165
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 164
Number of HSP's gapped (non-prelim): 2
length of query: 74
length of database: 30,389,216
effective HSP length: 50
effective length of query: 24
effective length of database: 27,352,316
effective search space: 656455584
effective search space used: 656455584
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)