ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV1765 suspect: LH S KOG3945 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV1765 610569 609916 -218 
         (218 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value CE04947_2 [S] KOG3945 Uncharacterized conserved protein 55 1e-07 >CE04947_2 [S] KOG3945 Uncharacterized conserved protein Length = 167 Score = 54.7 bits (130), Expect = 1e-07 Identities = 34/155 (21%), Positives = 68/155 (42%), Gaps = 19/155 (12%) Query: 50 TAHRYVAYTSDIGESFRPVFPQAVVKLGYGISWLYILGDVSYITYRAKLKQEGYQLPSGW 109 T RY+ Y +++GE+FR + VVK Y +++ Y+ D + G Sbjct: 17 TPLRYLGYANEVGEAFRSLVKPVVVKFSYVVAFGYVAAD---------------SIDKGL 61 Query: 110 KPWDELSENNKVLKSNVSPDWKMVGLERLIFQSVASMGLPAFTIHSLVKYSGNWFNKQYP 169 + + + + V+ + ++ +++Q+ AS+ +P FTI+ +S K Sbjct: 62 QEYIKTHSTSTEKTKKVA----IAAVDTVLWQTFASVLIPGFTINRFCFFSNLLLQKSTK 117 Query: 170 KNAMLRTWGPISIGLAVVPMLPYAFDKPIEHFLSK 204 +R W +GLA +P + + D +E + K Sbjct: 118 LPTNMRKWTVTCLGLATIPFIVHPIDSFVEEAMDK 152 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.319 0.136 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,738,871 Number of Sequences: 60738 Number of extensions: 566526 Number of successful extensions: 1227 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1226 Number of HSP's gapped (non-prelim): 1 length of query: 218 length of database: 30,389,216 effective HSP length: 102 effective length of query: 116 effective length of database: 24,193,940 effective search space: 2806497040 effective search space used: 2806497040 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)