ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV2187 suspect: LH S KOG4562 Function unknown Uncharacterized conserved protein (tumor-rejection antigen MAGE in humans)

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV2187 742932 742012 -307 
         (307 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR288w [S] KOG4562 Uncharacterized conserved protein (tumor-rej... 134 1e-31 >YDR288w [S] KOG4562 Uncharacterized conserved protein (tumor-rejection antigen MAGE in humans) Length = 303 Score = 134 bits (338), Expect = 1e-31 Identities = 85/285 (29%), Positives = 153/285 (52%), Gaps = 11/285 (3%) Query: 19 VGNLMVRFVLAQCESQTGNTVITRSKMLQKLKEIIDEEKVKSIPFSTVYGYVDDKLNEIF 78 V MVR++L++ ESQ N++ITR+K+ + E EE + FS ++ ++ L ++ Sbjct: 27 VARKMVRYILSRGESQ--NSIITRNKLQSVIHEAAREENIAKPSFSKMFMDINAILYNVY 84 Query: 79 GYHLFGVLAKKTDKRSFSQTQDEGTPDEANNSV-EDAKARGNHFILVRSGMEAIPQRYHK 137 G+ L G+ +K G+ N S+ E R FIL+ + + + + Sbjct: 85 GFELQGLPSKNN-----MNAGGNGSNSNTNKSMPEPLGHRAQKFILLNNVPHS--KNFDD 137 Query: 138 FILDHASAIYRKTVHQVTYIGKEYSASSNPTLDNEIGNNTELALKGIIAITICIVIFSKN 197 F + ++ Y + + YIG + ++ ++ TL++++ + +L KG++++ +CIV FSKN Sbjct: 138 FKILQSAHTYEELIVTGEYIGDDIASGTSNTLESKLSTDRDLVYKGVLSVILCIVFFSKN 197 Query: 198 NILETELSDQHGKFGISTEGHDIPIIDMNHKDLLNLLVRNNYLTRTVEKAADLGQELAIY 257 NIL EL FGI ++G I I+++ +DL+ L + Y+ R EK +D E+ Y Sbjct: 198 NILHQELIKFLETFGIPSDGSKIAILNITIEDLIKSLEKREYIVRLEEK-SDTDGEVISY 256 Query: 258 SIGKRTLVEFPKESLTKMCQEMLDLDDSQLELIENTVNVLAGDAY 302 IG+RT E ESL K+ QE++ L+ Q + + + + GD+Y Sbjct: 257 RIGRRTQAELGLESLEKLVQEIMGLEKEQTKSLHDDIIKSIGDSY 301 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.316 0.134 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,874,138 Number of Sequences: 60738 Number of extensions: 741612 Number of successful extensions: 2122 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2119 Number of HSP's gapped (non-prelim): 1 length of query: 307 length of database: 30,389,216 effective HSP length: 106 effective length of query: 201 effective length of database: 23,950,988 effective search space: 4814148588 effective search space used: 4814148588 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)