ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV2946 suspect: LH S KOG2612 Function unknown Predicted integral membrane protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV2946 998670  998960 97   
         (97 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YPL047w [S] KOG2612 Predicted integral membrane protein 116 6e-27 >YPL047w [S] KOG2612 Predicted integral membrane protein Length = 99 Score = 116 bits (290), Expect = 6e-27 Identities = 51/94 (54%), Positives = 74/94 (78%) Query: 4 SLTTDSVADSIYQNILTSIIQDIISRQTVKRKLLKLQFPDAKPYYADPSGTLDIHGKAKQ 63 ++T DS+++ I N+LT++IQDI++R+T +++LLK ++PD + YY DP+G+LDI+G KQ Sbjct: 5 TITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDLRSYYFDPNGSLDINGLQKQ 64 Query: 64 ADSAVYIECNVCGREVSGNRFAAHLVRCLSRGRR 97 +S+ YI C CGR+VS NR AAHL RCLSRG R Sbjct: 65 QESSQYIHCENCGRDVSANRLAAHLQRCLSRGAR 98 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,327,185 Number of Sequences: 60738 Number of extensions: 185957 Number of successful extensions: 566 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 565 Number of HSP's gapped (non-prelim): 1 length of query: 97 length of database: 30,389,216 effective HSP length: 73 effective length of query: 24 effective length of database: 25,955,342 effective search space: 622928208 effective search space used: 622928208 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)