ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV3414 suspect: LH Z KOG0613 Cytoskeleton Projectin/twitchin and related proteins

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV3414 1162749 1160941 -603 
         (603 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs19747267 [Z] KOG0613 Projectin/twitchin and related proteins 52 3e-06 >Hs19747267 [Z] KOG0613 Projectin/twitchin and related proteins Length = 34350 Score = 52.0 bits (123), Expect = 3e-06 Identities = 60/223 (26%), Positives = 95/223 (41%), Gaps = 39/223 (17%) Query: 7 KVPERPRRRITRSEEPEQLRSESEFEREKSGSKDSELDLPPVPKTRPNRKPLXXXXXXXX 66 KVPE P++ I ++P + + E K K + PVP P + Sbjct: 10986 KVPEVPKKLIPEEKKPTPVPKKVEAPPPKVPKKREPV---PVPVALPQEE---------- 11032 Query: 67 XXXXXXKPEPQIQAQLQPEAVIETEPTVEHPIVDELEAKLPVEQPVLDEVELDEPVTQEV 126 E + ++ PE + E E ++ E E LP E+ VL E E P +EV Sbjct: 11033 --------EVLFEEEIVPEEEVLPE---EEEVLPEEEEVLPEEEEVLPEEEEIPPEEEEV 11081 Query: 127 EPSGELLPEESTIKESLEEQIIDDFADE-----PVEEECKEVASPELI---GDEA--IQD 176 P E +PEE EE+++ + + PV E K+V +++ +EA + Sbjct: 11082 PPEEEYVPEEEEFVP--EEEVLPEVKPKVPVPAPVPEIKKKVTEKKVVIPKKEEAPPAKV 11139 Query: 177 EELEKPVKEEPIIQTDDKTLAEAIVPSVCEE---SEADIAEEP 216 E+ K V+E+ II ++ + V EE SE +I EEP Sbjct: 11140 PEVPKKVEEKRIILPKEEEVLPVEVTEEPEEEPISEEEIPEEP 11182 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.301 0.124 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,757,445 Number of Sequences: 60738 Number of extensions: 1328295 Number of successful extensions: 5142 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5117 Number of HSP's gapped (non-prelim): 14 length of query: 603 length of database: 30,389,216 effective HSP length: 112 effective length of query: 491 effective length of database: 23,586,560 effective search space: 11581000960 effective search space used: 11581000960 T: 11 A: 40 X1: 17 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.7 bits)