ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV3429 suspect: LH U KOG2148 Intracellular trafficking, secretion, and vesicular transport Exocyst protein Sec3

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV3429 1163768  1167475 1236 
         (1236 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7293990 [U] KOG2148 Exocyst protein Sec3 52 8e-06 >7293990 [U] KOG2148 Exocyst protein Sec3 Length = 841 Score = 51.6 bits (122), Expect = 8e-06 Identities = 36/143 (25%), Positives = 66/143 (45%), Gaps = 10/143 (6%) Query: 1092 QETKRLFDKEKESYSEMLMNSSMPALVAFVQGAYSLIETSGGNGFVDPKQWAAYSEQNLS 1151 +E K+ ++ ++Y + L F +G ++ + G + A+S+Q L Sbjct: 700 KEAKKCYNDALKAYVTQYFGRPLEKLNQFFEGVQ--LKVAQGVKETEISYQMAFSKQELR 757 Query: 1152 KILVSYTSQEVTALIGKLYNNMEAHFLSEANNKARDVLCQKLWSNIQGKVVSFYLMLYSL 1211 K++ Y ++EV + LY +E H E N L Q +W +Q + ++ Y L Sbjct: 758 KVIAQYPAREVKKGLENLYKKVEKHLSEEEN------LLQVVWHAMQEEFIAQYNYLEER 811 Query: 1212 IEKHYKNT--NIKFSKNDIIAAF 1232 I+K Y N++F+ DI+A F Sbjct: 812 IQKCYAGAMINLEFNIQDILAFF 834 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,213,139 Number of Sequences: 60738 Number of extensions: 2545528 Number of successful extensions: 6738 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6735 Number of HSP's gapped (non-prelim): 3 length of query: 1236 length of database: 30,389,216 effective HSP length: 118 effective length of query: 1118 effective length of database: 23,222,132 effective search space: 25962343576 effective search space used: 25962343576 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)