ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV3526 suspect: LH U KOG3385 Intracellular trafficking, secretion, and vesicular transport V-SNARE

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV3526 1200329  1200769 147  
         (147 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YIL004c [U] KOG3385 V-SNARE 142 2e-34 >YIL004c [U] KOG3385 V-SNARE Length = 142 Score = 142 bits (358), Expect = 2e-34 Identities = 77/146 (52%), Positives = 97/146 (65%), Gaps = 5/146 (3%) Query: 1 MSSNYSGMQGDLTQRDASRTQLFAGTDFSKYKQQQXXXXXXXXXXXXGVDYSQATLSQLE 60 MSS ++G G+ QRD RTQLF D S +DYSQ+TL+ LE Sbjct: 1 MSSRFAG--GNAYQRDTGRTQLFGPADGSNSLDDNVSSALGSTDK---LDYSQSTLASLE 55 Query: 61 SQSDEQMNTMSEKINALKNLSLRMGDEIRGSNQTLDQLGNVFEQTSNRLKRTFKRMMVMA 120 SQS+EQM M ++I ALK+LSL+MGDEIRGSNQT+DQLG+ F TS +LKRTF MM MA Sbjct: 56 SQSEEQMGAMGQRIKALKSLSLKMGDEIRGSNQTIDQLGDTFHNTSVKLKRTFGNMMEMA 115 Query: 121 QNSRIPLKIWFIIFGVLTLLFFYVWI 146 + S I +K W IIF ++ +LFF+VWI Sbjct: 116 RRSGISIKTWLIIFFMVGVLFFWVWI 141 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.320 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,452,238 Number of Sequences: 60738 Number of extensions: 187126 Number of successful extensions: 774 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 772 Number of HSP's gapped (non-prelim): 1 length of query: 147 length of database: 30,389,216 effective HSP length: 96 effective length of query: 51 effective length of database: 24,558,368 effective search space: 1252476768 effective search space used: 1252476768 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)