ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV3787 suspect: LH S KOG4346 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV3787 1281895  1283892 666  
         (666 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value SPAC458.03 [S] KOG4346 Uncharacterized conserved protein 62 3e-09 >SPAC458.03 [S] KOG4346 Uncharacterized conserved protein Length = 868 Score = 62.0 bits (149), Expect = 3e-09 Identities = 39/133 (29%), Positives = 73/133 (54%), Gaps = 7/133 (5%) Query: 438 LKETVKLVRQKKNFPTEVSFYSKELLKKIATISNKFDEKSFEEWKANALVSILVVCPDKI 497 L+ KL+++K F TE+ ++ ELL+ + ++ N+FD +F+E + A+V +L+ C D Sbjct: 530 LENASKLIKRKSAFGTELRDHADELLQTLISLQNRFDLMNFDEMQMTAIVELLLTCLDIC 589 Query: 498 VDLYAI-LFNNELSLQQRMVILTSAALSARELRGFDDEFVVKPKYDFPTNRLPWDESATE 556 + LF ++ S++Q+++IL+ +L+A + D+E + FP+ LP + Sbjct: 590 GPVICTNLFVSDYSMRQKILILSCISLAASKFNDDDNERL------FPSQLLPGNLHDQF 643 Query: 557 QQPENNKIQDITE 569 P KI D E Sbjct: 644 YSPTIEKISDELE 656 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,510,017 Number of Sequences: 60738 Number of extensions: 1501605 Number of successful extensions: 3882 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3882 Number of HSP's gapped (non-prelim): 1 length of query: 666 length of database: 30,389,216 effective HSP length: 113 effective length of query: 553 effective length of database: 23,525,822 effective search space: 13009779566 effective search space used: 13009779566 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)