ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV3987 suspect: LH J KOG3504 Translation, ribosomal structure and biogenesis 60S ribosomal protein L29

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV3987 1353657 1352383 -425 
         (425 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YFR032c [J] KOG3504 60S ribosomal protein L29 80 4e-15 >YFR032c [J] KOG3504 60S ribosomal protein L29 Length = 289 Score = 80.5 bits (197), Expect = 4e-15 Identities = 41/90 (45%), Positives = 59/90 (65%), Gaps = 4/90 (4%) Query: 7 VYISNLSFEASENQLYEYLQDYNVISVLIPSQTVRGLKNK----AVRPFGIAYAEFSNEE 62 VYISNL F ASE L+ +L +Y SVLIP+QTVR + +P GIA+A+F+N Sbjct: 20 VYISNLPFTASERDLHAFLNNYGASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANNT 79 Query: 63 DANKVIQELNGKLFMERHLNLRMHIPIDSN 92 A K IQ+LNG +F + L L++H+P +++ Sbjct: 80 LALKAIQDLNGTVFQNQKLFLKLHVPYEAD 109 Score = 57.4 bits (137), Expect = 4e-08 Identities = 33/92 (35%), Positives = 55/92 (58%), Gaps = 5/92 (5%) Query: 238 IPRNTTDNQLREYFKGFDPQEIVVFKNRTYRR---GFTFHRHFTAALVTFPDAFRLND-A 293 +P + TD+++RE F+ + PQEI +++++ YRR F H+ TAALVT + D Sbjct: 141 LPDDITDSEIRELFQLYSPQEIWIYRSKVYRRKCIPFAPHQ-ITAALVTLQSETPIGDIC 199 Query: 294 KQFATQEKFRGKQINVKNAFIEKIEEVQRALE 325 A RGK I VK A++ KI+E+++ ++ Sbjct: 200 DSVAKTATLRGKSIIVKPAYVSKIQEIKQLVK 231 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.310 0.128 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,096,592 Number of Sequences: 60738 Number of extensions: 963393 Number of successful extensions: 3489 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3486 Number of HSP's gapped (non-prelim): 2 length of query: 425 length of database: 30,389,216 effective HSP length: 109 effective length of query: 316 effective length of database: 23,768,774 effective search space: 7510932584 effective search space used: 7510932584 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)