ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4185 suspect: LH F KOG1018 Nucleotide transport and metabolism Cytosine deaminase FCY1 and related enzymes

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4185 1418383  1419348 322  
         (322 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value SPCC4G3.16 [F] KOG1018 Cytosine deaminase FCY1 and related enzymes 64 4e-10 >SPCC4G3.16 [F] KOG1018 Cytosine deaminase FCY1 and related enzymes Length = 405 Score = 63.5 bits (153), Expect = 4e-10 Identities = 70/291 (24%), Positives = 118/291 (40%), Gaps = 77/291 (26%) Query: 32 DLGILSRNESELEIDIGPHRLVTRKKKAPERDEYTFSIHQNLTSLNSNRDNNNSTTGYVI 91 DLG+L + ++ + IG + + Q+L SL+ +R +TG V+ Sbjct: 31 DLGMLDSKQEQIALTIGNKPI---------------KVKQSLQSLHQSR----GSTGSVL 71 Query: 92 WTTSTFILKWLLYNDNATIFTRGGVKDEVDITSIFQCQQDDKLRYVLELGTGTSPMFPIV 151 W TS ++ WLL S F K +LELG+G S + I+ Sbjct: 72 WKTSVKVVPWLLQQ------------------SWFMNSLTPKTS-ILELGSGISGLAGIL 112 Query: 152 FSNYVDKYVATDQKDILPRLKDNIQENQSECRRRLLKSNTIALDDLKRRTELECQIDIAL 211 S +V YVA+D++ L ++++N+ +N + +++ Sbjct: 113 LSPFVGNYVASDKQLYLKKIRENLDQNNAS------------------------DVEVHE 148 Query: 212 LDWELFSGSKKSRNDPVLQCGPNFHLTIIAMDVIYNEYLIVPFLTTLESLFVWYTEQRVT 271 LDW+ K D F ++ D IYN +L ++ L SL E+ Sbjct: 149 LDWKSTPYPKDWTFD--------FLDYVLFFDCIYNPHLNAHLVSCLASL----AERYPG 196 Query: 272 VSALIGIQLRTQDVLEMFLEEAIIERQFIVHAVDEKELNKSRFILLHVNLP 322 + L +LR Q+ L FLE + F V + +E+NK+ + NLP Sbjct: 197 MQCLFAQELRDQETLVDFLER--VRPYFEVDLIKMEEINKTS-VASSTNLP 244 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,172,837 Number of Sequences: 60738 Number of extensions: 832423 Number of successful extensions: 2217 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2216 Number of HSP's gapped (non-prelim): 2 length of query: 322 length of database: 30,389,216 effective HSP length: 106 effective length of query: 216 effective length of database: 23,950,988 effective search space: 5173413408 effective search space used: 5173413408 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)