ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4222 suspect: LH S KOG3228 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4222 1432077  1432637 187  
         (187 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR163w [S] KOG3228 Uncharacterized conserved protein 98 8e-21 >YDR163w [S] KOG3228 Uncharacterized conserved protein Length = 175 Score = 97.8 bits (242), Expect = 8e-21 Identities = 66/193 (34%), Positives = 93/193 (47%), Gaps = 24/193 (12%) Query: 1 MTTSHRPQLEARNGAKNIEYIPTSTQHARLLPGHKEVKYRNTKKRVLNRKVESTPSEEAK 60 MTTSHRPQLEAR+GAK Y PT +HARLLPGH +KYR K+ + + ++E + Sbjct: 1 MTTSHRPQLEARSGAKAAAYTPTGIEHARLLPGHTTLKYRKFKE---EENLRANCAQEDR 57 Query: 61 KRIKITGAEECSKDEEIQATXXXXXXXXXXXXXXXXXXXXXXWNKVKQERLDKKLREQRA 120 K EE +EE Q K +++ L + L Q+ Sbjct: 58 SNDK--SLEEAVMNEEKQDVVGSGNLQETRS------------EKDQKDSLQELLVTQKN 103 Query: 121 EITAAQNEEVTKPQKHG-----GWRSNTVFGRKGTVNQSASISEH-NSNGKGKYVNNITQ 174 ++ E + K G WR T FGR V + +I EH Y+N++T+ Sbjct: 104 KVEDKAELEGNEQLKGGNSSRRSWRKGTAFGRH-KVTKETNIKEHATKKSASGYINDMTK 162 Query: 175 SEYHKEFIRKHVK 187 SEYH+EF+ KHV+ Sbjct: 163 SEYHQEFLHKHVR 175 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.307 0.124 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,013,863 Number of Sequences: 60738 Number of extensions: 359201 Number of successful extensions: 1068 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1066 Number of HSP's gapped (non-prelim): 1 length of query: 187 length of database: 30,389,216 effective HSP length: 100 effective length of query: 87 effective length of database: 24,315,416 effective search space: 2115441192 effective search space used: 2115441192 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)