ORF STATUS Function Best COG Functional category Pathways and functional systems
r_klactIV4414.1 suspect: LH K KOG0048 Transcription Transcription factor, Myb superfamily
Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= r_klactIV4414.1 1501966 1502112 49
(49 letters)
Database: KOG eukaryal database 04/03
60,738 sequences; 30,389,216 total letters
Searching..................................................done
Color Key for Alignment Scores:
Score E
Sequences producing significant alignments: (bits) Value
YKR099w [K] KOG0048 Transcription factor Myb superfamily 27 5.3
>YKR099w [K] KOG0048 Transcription factor Myb superfamily
Length = 811
Score = 26.9 bits (58), Expect = 5.3
Identities = 18/53 (33%), Positives = 27/53 (49%), Gaps = 13/53 (24%)
Query: 6 KSSRSSMDSD------------LEAFSHNPADGSFAAMPDQTAAKTNYPNELF 46
++S +MDSD LEA SHNPAD + + Q+ +TN P+ +
Sbjct: 511 RTSLDNMDSDFLSRTPNYNAFSLEATSHNPADNA-NELGSQSNRETNSPSVFY 562
Database: KOG eukaryal database 04/03
Posted date: Apr 14, 2003 1:07 PM
Number of letters in database: 30,389,216
Number of sequences in database: 60,738
Lambda K H
0.310 0.121 0.340
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,656,573
Number of Sequences: 60738
Number of extensions: 59582
Number of successful extensions: 116
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 116
Number of HSP's gapped (non-prelim): 1
length of query: 49
length of database: 30,389,216
effective HSP length: 25
effective length of query: 24
effective length of database: 28,870,766
effective search space: 692898384
effective search space used: 692898384
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)