ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4414.1 suspect: LH K KOG0048 Transcription Transcription factor, Myb superfamily

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4414.1 1501966  1502112 49   
         (49 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YKR099w [K] KOG0048 Transcription factor Myb superfamily 27 5.3 >YKR099w [K] KOG0048 Transcription factor Myb superfamily Length = 811 Score = 26.9 bits (58), Expect = 5.3 Identities = 18/53 (33%), Positives = 27/53 (49%), Gaps = 13/53 (24%) Query: 6 KSSRSSMDSD------------LEAFSHNPADGSFAAMPDQTAAKTNYPNELF 46 ++S +MDSD LEA SHNPAD + + Q+ +TN P+ + Sbjct: 511 RTSLDNMDSDFLSRTPNYNAFSLEATSHNPADNA-NELGSQSNRETNSPSVFY 562 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.310 0.121 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,656,573 Number of Sequences: 60738 Number of extensions: 59582 Number of successful extensions: 116 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 116 Number of HSP's gapped (non-prelim): 1 length of query: 49 length of database: 30,389,216 effective HSP length: 25 effective length of query: 24 effective length of database: 28,870,766 effective search space: 692898384 effective search space used: 692898384 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)