ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4440.1   suspect: LH  K     KOG0048   Transcription                                                  Transcription factor, Myb superfamily

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4440.1 1510677  1510823 49   
         (49 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YKR099w [K] KOG0048 Transcription factor Myb superfamily               27   5.3  

>YKR099w [K] KOG0048 Transcription factor Myb superfamily
          Length = 811

 Score = 26.9 bits (58), Expect = 5.3
 Identities = 18/53 (33%), Positives = 27/53 (49%), Gaps = 13/53 (24%)

Query: 6   KSSRSSMDSD------------LEAFSHNPADGSFAAMPDQTAAKTNYPNELF 46
           ++S  +MDSD            LEA SHNPAD +   +  Q+  +TN P+  +
Sbjct: 511 RTSLDNMDSDFLSRTPNYNAFSLEATSHNPADNA-NELGSQSNRETNSPSVFY 562


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.310    0.121    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,656,573
Number of Sequences: 60738
Number of extensions: 59582
Number of successful extensions: 116
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 116
Number of HSP's gapped (non-prelim): 1
length of query: 49
length of database: 30,389,216
effective HSP length: 25
effective length of query: 24
effective length of database: 28,870,766
effective search space: 692898384
effective search space used: 692898384
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)