ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4469.1   suspect: LH  T     KOG3521   Signal transduction mechanisms                                 Predicted guanine nucleotide exchange factor

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4469.1 1519454 1519320 -45  
         (45 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CE04926 [T] KOG3521 Predicted guanine nucleotide exchange factor       27   7.0  

>CE04926 [T] KOG3521 Predicted guanine nucleotide exchange factor
          Length = 862

 Score = 26.6 bits (57), Expect = 7.0
 Identities = 12/34 (35%), Positives = 19/34 (55%)

Query: 6   DFENEKYIFNFYKNEDVNFDNLHKNNGHPLLLRT 39
           D EN    FNF    +VN+D+L   +  P+L ++
Sbjct: 171 DIENRLVFFNFVTLFNVNYDSLWLQSIEPILAKS 204


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.326    0.144    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,213,165
Number of Sequences: 60738
Number of extensions: 92844
Number of successful extensions: 286
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 285
Number of HSP's gapped (non-prelim): 1
length of query: 45
length of database: 30,389,216
effective HSP length: 21
effective length of query: 24
effective length of database: 29,113,718
effective search space: 698729232
effective search space used: 698729232
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)