ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4472 suspect: LH GOU KOG1442 Carbohydrate transport and metabolism GDP-fucose transporter r_klactIV4472 suspect: LH GOU KOG1442 Intracellular trafficking, secretion, and vesicular transport GDP-fucose transporter r_klactIV4472 suspect: LH GOU KOG1442 Posttranslational modification, protein turnover, chaperones GDP-fucose transporter

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4472 gi|132471|sp|P09806|RF4_KLULA 
         (204 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value CE05478 [GOU] KOG1442 GDP-fucose transporter 28 6.6 Hs7705433 [JK] KOG3677 RNA polymerase I-associated factor - PAF67 28 8.7 >CE05478 [GOU] KOG1442 GDP-fucose transporter Length = 416 Score = 28.5 bits (62), Expect = 6.6 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 10/59 (16%) Query: 100 ILSSISAIYIMSNKVCDFTFKYLLSGV---------WYPNVPTKETCIYLSEKDPRYSL 149 +++++SA ++ S + F KYLLS V WY + T C++LS+ Y L Sbjct: 83 VITAVSAYWVFSIGLV-FLNKYLLSSVQLDAPLFITWYQCLVTVFLCLFLSKTSKAYGL 140 >Hs7705433 [JK] KOG3677 RNA polymerase I-associated factor - PAF67 Length = 564 Score = 28.1 bits (61), Expect = 8.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 10 VRKKFRRHSKYRTISQFQLKICLELENNLSDYFKA 44 V ++ RHS Y+ + F L L L + L DY++A Sbjct: 256 VAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQA 290 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.327 0.141 0.446 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,697,348 Number of Sequences: 60738 Number of extensions: 457864 Number of successful extensions: 1141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1140 Number of HSP's gapped (non-prelim): 2 length of query: 204 length of database: 30,389,216 effective HSP length: 101 effective length of query: 103 effective length of database: 24,254,678 effective search space: 2498231834 effective search space used: 2498231834 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits)