ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4531.1 suspect: LH P KOG3826 Inorganic ion transport and metabolism Na+/H+ antiporter

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4531.1 1545817 1545395 -141 
         (141 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs17462659 [P] KOG3826 Na+/H+ antiporter 34 0.055 7303134 [G] KOG2532 Permease of the major facilitator superfamily 27 6.7 >Hs17462659 [P] KOG3826 Na+/H+ antiporter Length = 454 Score = 34.3 bits (77), Expect = 0.055 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 5/60 (8%) Query: 87 LLDVVVGQSST-----IFQLLTSKDQSLLVWRNTFLVLDLRLNIVNGVGRFDFQGNGLTC 141 +L+VV+G ++ Q S+DQ LV + TFLVL L + V F F G+G C Sbjct: 307 VLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFPGSGGLC 366 >7303134 [G] KOG2532 Permease of the major facilitator superfamily Length = 524 Score = 27.3 bits (59), Expect = 6.7 Identities = 14/39 (35%), Positives = 21/39 (52%), Gaps = 7/39 (17%) Query: 85 GFLLDVVVGQSSTIFQLLTSKDQSLLVWRNTFLVLDLRL 123 GF+ +VGQ LT +Q++ W+N FL+ L L Sbjct: 419 GFISPFIVGQ-------LTHNNQTIDAWKNVFLLTSLML 450 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.327 0.143 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,452,000 Number of Sequences: 60738 Number of extensions: 99908 Number of successful extensions: 226 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 225 Number of HSP's gapped (non-prelim): 2 length of query: 141 length of database: 30,389,216 effective HSP length: 95 effective length of query: 46 effective length of database: 24,619,106 effective search space: 1132478876 effective search space used: 1132478876 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits)