ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4656.1   suspect: LH  R     KOG3564   General function prediction only                               GTPase-activating protein

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4656.1 1593016  1593183 56   
         (56 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

7303262 [R] KOG3564 GTPase-activating protein                          29   1.4  

>7303262 [R] KOG3564 GTPase-activating protein
          Length = 625

 Score = 28.9 bits (63), Expect = 1.4
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 3   LTKSTEPLVLTNSGKQALTVLKLPKRSIDTTDLKAFEDRCVKSAKKLPAA 52
           L   TEPL+ T+  K     ++ P       D K  +D  VKS K+LP A
Sbjct: 457 LRSLTEPLIPTSQWKDFANAVQNP-------DTKTAQDMLVKSVKQLPQA 499


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.311    0.126    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,786,873
Number of Sequences: 60738
Number of extensions: 70587
Number of successful extensions: 113
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 113
Number of HSP's gapped (non-prelim): 1
length of query: 56
length of database: 30,389,216
effective HSP length: 32
effective length of query: 24
effective length of database: 28,445,600
effective search space: 682694400
effective search space used: 682694400
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)