ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4686.1 suspect: LH R KOG0379 General function prediction only Kelch repeat-containing proteins

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4686.1 1602283  1602531 83   
         (83 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs14744278 [R] KOG0379 Kelch repeat-containing proteins 28 2.2 7294100 [C] KOG3619 Adenylate/guanylate cyclase 27 6.5 >Hs14744278 [R] KOG0379 Kelch repeat-containing proteins Length = 299 Score = 28.1 bits (61), Expect = 2.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 4 SIVEVSWDGNDSLFDLLTNLSFSNFLHLGQDHG 36 S++E++W+ + F L NLS + LHLG G Sbjct: 261 SLLELAWEKLLAAFPNLANLSRTQLLHLGLTQG 293 >7294100 [C] KOG3619 Adenylate/guanylate cyclase Length = 1597 Score = 26.6 bits (57), Expect = 6.5 Identities = 11/35 (31%), Positives = 16/35 (45%) Query: 9 SWDGNDSLFDLLTNLSFSNFLHLGQDHGGNFLWRK 43 SW GN ++ L + N DH G +WR+ Sbjct: 177 SWAGNGAVGGELKSAHNHNIADFEADHNGQLVWRR 211 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.325 0.144 0.477 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,224,289 Number of Sequences: 60738 Number of extensions: 204070 Number of successful extensions: 400 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 398 Number of HSP's gapped (non-prelim): 2 length of query: 83 length of database: 30,389,216 effective HSP length: 59 effective length of query: 24 effective length of database: 26,805,674 effective search space: 643336176 effective search space used: 643336176 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits)