ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4712 suspect: LH U KOG2395 Intracellular trafficking, secretion, and vesicular transport Protein involved in vacuole import and degradation

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4712 1612193 1611327 -289 
         (289 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YNL212w [U] KOG2395 Protein involved in vacuole import and degra... 114 2e-25 >YNL212w [U] KOG2395 Protein involved in vacuole import and degradation Length = 782 Score = 114 bits (284), Expect = 2e-25 Identities = 62/201 (30%), Positives = 111/201 (54%), Gaps = 5/201 (2%) Query: 1 MNFIRTFFDSNSNEELLSISAGQFLLLRSFKSPKSSVEYIFSDAMICVKRRGDYDYILHV 60 MN ++ F +S + EL++I +GQF LLRS SPK+++E I+++A + V++ G +DY L V Sbjct: 1 MNILKKFMESGNKPELITIPSGQFNLLRSKNSPKAALECIYNNATLSVRKIGKFDYELAV 60 Query: 61 ERQXXXXXXXXXXXXXXLVPDEMSLLSATS-KKDDTWAFKIEEDLQFVKSWNAERHSVFI 119 R D +S+LS S KK++ W+ +I + + F K+W+ + + + Sbjct: 61 YRVEDDSEGGTGDEAENFEDDTISVLSTQSKKKEEEWSVEISDKIMFHKTWDKQGNVALV 120 Query: 120 WNNTKGDDGDQ-FEYIIDDTIPLLEIEKFYKLVKHCTFEAKYRKPSDQATKQELLEFMKP 178 W N +GD+ D+ ++++ + ++E+F + V C FE + +K S A+ +L E Sbjct: 121 WENLRGDEQDEKVQFVVAADVSFSDVEQFIQTVYRCQFEVRNKKSSLTASADDLKEI--- 177 Query: 179 EELDDSPFFSDEYNELRTDSD 199 E F D+ +EL + SD Sbjct: 178 EHRSTRLFVQDDDDELDSSSD 198 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.315 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,236,093 Number of Sequences: 60738 Number of extensions: 629126 Number of successful extensions: 1648 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1644 Number of HSP's gapped (non-prelim): 1 length of query: 289 length of database: 30,389,216 effective HSP length: 105 effective length of query: 184 effective length of database: 24,011,726 effective search space: 4418157584 effective search space used: 4418157584 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)