ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactIV4753 suspect: LH T KOG0371 Signal transduction mechanisms Serine/threonine protein phosphatase 2A, catalytic subunit

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactIV4753 1624908 1623979 -310 
         (310 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YNL217w [T] KOG0371 Serine/threonine protein phosphatase 2A cata... 179 3e-45 >YNL217w [T] KOG0371 Serine/threonine protein phosphatase 2A catalytic subunit Length = 326 Score = 179 bits (455), Expect = 3e-45 Identities = 119/327 (36%), Positives = 184/327 (55%), Gaps = 29/327 (8%) Query: 2 KLAQILTASGTFLFMLYVTWVFLKSDDYREFPVIQT-------KRHADIKHSYERLVFVG 54 + A + TA F+ T K D+ R P + K+ + + VFVG Sbjct: 8 RAATLSTALILFVACCVYTLYIFKFDNPRLSPPVSLLPTISTLKKIEHVTDLNKEYVFVG 67 Query: 55 DVHGMYHKYEQLMEDKVKP-DSNTTVVFLGDFISKGPNSNRLVEQIILNDDVGYDVKCVL 113 DVHG Y ++ +L++DK+ N T++ LGDFI KGP+S+++V I+ + D VKCVL Sbjct: 68 DVHGNYDEFIELIDDKIGGLGENITMILLGDFIHKGPDSDKVVSYILNHKD---QVKCVL 124 Query: 114 GNNELRILYALLNP-ISLTKRK---LIKIKFSSE-DFLP-DLPSINKNHRRLARELGWDN 167 GN+E+ ++ A LNP S R+ + + FS+E +F+P D+ I+ H RLARELG+ Sbjct: 125 GNHEILVMMAYLNPDFSKWVRRPKLMTPLTFSTETNFIPQDISKISNAHGRLARELGFSK 184 Query: 168 LARLAAKCGAMWELQDPLYDNFTLVAVHAGVLPDHLGNPP----LKEITDMKYVDVNDHS 223 L++LA C EL + + L HAG++P P + +++MKYVD + S Sbjct: 185 LSQLAEHCSMAIELDLDITGDI-LFGAHAGMVPGDFMKPNQIPGVSSLSNMKYVDKKNWS 243 Query: 224 HTTRQKF-ENATRWYHLWNPLDKKKYSIH-NKIKVIYGHDSSKGLNIRPNTKGLDSACYN 281 T+R+K +N RWY LW+ KY H + KV YGHD+S GLN+R TKGLD+AC Sbjct: 244 KTSREKENKNYVRWYTLWD-----KYGDHFSNAKVFYGHDASMGLNLRRQTKGLDTACIK 298 Query: 282 GNKLTALEYVWNHKTKEYNHIMHQISC 308 N L++++ ++ K +Y++ + Q+ C Sbjct: 299 NNLLSSMKVKYDIKKGQYDYELIQVQC 325 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.320 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,153,624 Number of Sequences: 60738 Number of extensions: 887531 Number of successful extensions: 1971 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1965 Number of HSP's gapped (non-prelim): 1 length of query: 310 length of database: 30,389,216 effective HSP length: 106 effective length of query: 204 effective length of database: 23,950,988 effective search space: 4886001552 effective search space used: 4886001552 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)