ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactMIT21    suspect: LH   C     KOG3025  Energy production and conversion                               Mitochondrial F1F0-ATP synthase, subunit c/ATP9/proteolipid

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactMIT21   2185   2394  70   
         (70 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YMi018 [C] KOG3025 Mitochondrial F1F0-ATP synthase subunit c/ATP...    55   1e-08

>YMi018 [C] KOG3025 Mitochondrial F1F0-ATP synthase subunit
          c/ATP9/proteolipid
          Length = 76

 Score = 55.5 bits (132), Expect = 1e-08
 Identities = 29/53 (54%), Positives = 32/53 (59%)

Query: 18 QLVLAAKYXXXXXXXXXXXXXXXXXXXVFSALIQGVSRNPSLKDTLFPFAILG 70
          QLVLAAKY                   VF+ALI GVSRNPS+KDT+FP AILG
Sbjct: 2  QLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILG 54


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.329    0.143    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,501,857
Number of Sequences: 60738
Number of extensions: 18751
Number of successful extensions: 46
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 45
Number of HSP's gapped (non-prelim): 1
length of query: 70
length of database: 30,389,216
effective HSP length: 46
effective length of query: 24
effective length of database: 27,595,268
effective search space: 662286432
effective search space used: 662286432
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)