ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactMIT362   suspect: LH   C     KOG4664  Energy production and conversion                               Cytochrome oxidase subunit III and related proteins

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactMIT362  33021  33488 156  
         (156 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Hs22060643 [C] KOG4664 Cytochrome oxidase subunit III and relate...    54   7e-08

>Hs22060643 [C] KOG4664 Cytochrome oxidase subunit III and related proteins
          Length = 130

 Score = 54.3 bits (129), Expect = 7e-08
 Identities = 27/65 (41%), Positives = 35/65 (53%)

Query: 67  MFNVVTMKLMAPNNDEMDVKCKAKIAKSTLGPECAWIDDNGGYTVHPVPAPDSTNVEVTK 126
           +  +V +KL+AP  +E   K   KI KST  P C      GG TV PVP P ST V+ + 
Sbjct: 6   ILTIVVIKLIAPEAEETPAKWSEKIVKSTEAPACVRFPAKGGETVQPVPVPASTIVDASN 65

Query: 127 HTKAG 131
           + K G
Sbjct: 66  NRKEG 70


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.313    0.129    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,847,767
Number of Sequences: 60738
Number of extensions: 358244
Number of successful extensions: 558
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 557
Number of HSP's gapped (non-prelim): 1
length of query: 156
length of database: 30,389,216
effective HSP length: 97
effective length of query: 59
effective length of database: 24,497,630
effective search space: 1445360170
effective search space used: 1445360170
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)