ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV0724 suspect: LH A KOG0533 RNA processing and modification RRM motif-containing protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV0724  256959  257240 94   
         (94 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR381w [A] KOG0533 RRM motif-containing protein 47 6e-06 >YDR381w [A] KOG0533 RRM motif-containing protein Length = 226 Score = 46.6 bits (109), Expect = 6e-06 Identities = 37/95 (38%), Positives = 43/95 (44%), Gaps = 10/95 (10%) Query: 1 MSA-LDQSLDEIIGSAKHARRNNKAG------PKKVSKQVNKSRTRTGAGXXXXXXXXXX 53 MSA LD+SLDEIIGS K + G P++V KQV R Sbjct: 1 MSANLDKSLDEIIGSNKAGSNRARVGGTRGNGPRRVGKQVGSQRRSLPNRRGPIRKNTRA 60 Query: 54 XXXXXXXXXXXXISTR---VNVEGLPRDINQDAVK 85 +TR VNVEGLPRDI QDAV+ Sbjct: 61 PPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVR 95 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.312 0.127 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,514,433 Number of Sequences: 60738 Number of extensions: 67949 Number of successful extensions: 138 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 137 Number of HSP's gapped (non-prelim): 1 length of query: 94 length of database: 30,389,216 effective HSP length: 70 effective length of query: 24 effective length of database: 26,137,556 effective search space: 627301344 effective search space used: 627301344 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)