ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV0919 suspect: LH K KOG4109 Transcription Histone H3 (Lys4) methyltransferase complex, subunit CPS25/DPY-30

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV0919  319904 319503 -134 
         (134 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDR469w [K] KOG4109 Histone H3 (Lys4) methyltransferase complex ... 70 1e-12 SPCC18.11c [K] KOG4109 Histone H3 (Lys4) methyltransferase compl... 62 2e-10 >YDR469w [K] KOG4109 Histone H3 (Lys4) methyltransferase complex subunit CPS25/DPY-30 Length = 175 Score = 69.7 bits (169), Expect = 1e-12 Identities = 32/55 (58%), Positives = 44/55 (79%) Query: 74 DRVDPVAMIGGSTTRRYLNEHVTKHLLEGMKLIAREKPEDPLRVLGQFLIDASEM 128 + V+ A +GGS TR+YLN +VT HLL GM+LIA ++PEDPLRVLG++LI+ S + Sbjct: 109 ENVNLAATVGGSQTRKYLNTNVTPHLLAGMRLIAVQQPEDPLRVLGEYLIEQSNI 163 >SPCC18.11c [K] KOG4109 Histone H3 (Lys4) methyltransferase complex subunit CPS25/DPY-30 Length = 109 Score = 62.4 bits (150), Expect = 2e-10 Identities = 29/51 (56%), Positives = 39/51 (75%) Query: 81 MIGGSTTRRYLNEHVTKHLLEGMKLIAREKPEDPLRVLGQFLIDASEMNQK 131 M + R+YLNE VT LLEGMK++AR++PE+PL+ LGQFL+DA+ QK Sbjct: 1 MSNSAPARQYLNEKVTPVLLEGMKILARDRPENPLQFLGQFLLDANANQQK 51 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.310 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,635,160 Number of Sequences: 60738 Number of extensions: 272461 Number of successful extensions: 491 Number of sequences better than 1.0e-05: 2 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 489 Number of HSP's gapped (non-prelim): 2 length of query: 134 length of database: 30,389,216 effective HSP length: 94 effective length of query: 40 effective length of database: 24,679,844 effective search space: 987193760 effective search space used: 987193760 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)