ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV0990 suspect: LH R KOG0017 General function prediction only FOG: Transposon-encoded proteins with TYA, reverse transcriptase, integrase domains in various combinations

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV0990  343965 342940 -342 
         (342 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YPR158w [R] KOG0017 FOG: Transposon-encoded proteins with TYA re... 55 2e-07 >YPR158w [R] KOG0017 FOG: Transposon-encoded proteins with TYA reverse transcriptase integrase domains in various combinations Length = 252 Score = 54.7 bits (130), Expect = 2e-07 Identities = 34/139 (24%), Positives = 65/139 (46%), Gaps = 3/139 (2%) Query: 34 YQVQHLPNEIIVDLKKTAPKETIEHHILSHVRNFQDT--IPRYKLVTDWLGNQYYVENDI 91 + V+ + I+ L K + I + + + IP Y+L++D GNQ YVE + Sbjct: 48 FSVRKVNQSYIISLHKEITCQLIAEIVKQKLSRIWEKVYIPSYELISDKDGNQIYVEQSV 107 Query: 92 NQETIFNEVLRSINWTQFGINMCKKLFRDYDIQLKHDGKELRVTSKMDGIDQIFELNEEV 151 ++ + +E++ ++ I + LF DY ++L + ++S D + F N + Sbjct: 108 DENRLTSEIMEKLDPNNIDIEAIEILFDDYHLELSRLTNGIIISSANDHFYREFSFNNII 167 Query: 152 DD-VEIMGLQLSDDLHDAV 169 DD +I G +S D D + Sbjct: 168 DDNFKICGTSMSADSFDKI 186 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.315 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,808,023 Number of Sequences: 60738 Number of extensions: 804783 Number of successful extensions: 5432 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5431 Number of HSP's gapped (non-prelim): 1 length of query: 342 length of database: 30,389,216 effective HSP length: 107 effective length of query: 235 effective length of database: 23,890,250 effective search space: 5614208750 effective search space used: 5614208750 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)