ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV1165 good J KOG3162 Translation, ribosomal structure and biogenesis Mitochondrial/chloroplast ribosomal protein S18

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV1165 410281 409817 -155 
         (155 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YER050c [J] KOG3162 Mitochondrial/chloroplast ribosomal protein S18 119 2e-27 SPCC18B5.04 [J] KOG3162 Mitochondrial/chloroplast ribosomal prot... 74 8e-14 Hs22055525 [J] KOG3162 Mitochondrial/chloroplast ribosomal prote... 51 7e-07 Hs7705630 [J] KOG3162 Mitochondrial/chloroplast ribosomal protei... 50 1e-06 >YER050c [J] KOG3162 Mitochondrial/chloroplast ribosomal protein S18 Length = 202 Score = 119 bits (297), Expect = 2e-27 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 1/100 (1%) Query: 39 KKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGSF-DPFNKLKINPLDLYTNPEF 97 KK++ L K G++Y+PFDFS+ RIHLD+K+ S + K NPL+ Y P Sbjct: 103 KKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNRNDIMKSGANPLEFYARPRI 162 Query: 98 LSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLM 137 LSR+VTSTG+I HRD+TGLSAKNQRRL+KAI+RCQAIGLM Sbjct: 163 LSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIGLM 202 >SPCC18B5.04 [J] KOG3162 Mitochondrial/chloroplast ribosomal protein S18 Length = 166 Score = 73.9 bits (180), Expect = 8e-14 Identities = 47/131 (35%), Positives = 70/131 (52%), Gaps = 8/131 (6%) Query: 21 DQKLLKEGMSEANSKPTIKK-----LESKLIKNFQPGSVYNPFDFSLERIHLDK--KFGV 73 D + E SEA+S ++ + S L + + G +Y+P D E + KF Sbjct: 33 DNRKFNERNSEASSNVGFQRRVRSNIPSYLSASVEEGDIYSPNDLLFETVKAKNQAKF-Y 91 Query: 74 RPGSFDPFNKLKINPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQA 133 P D F + NP++ + NP LSRFVT G+I R TGL+AKNQR L++AI+R +A Sbjct: 92 EPVREDCFKTVNENPMNYWKNPVILSRFVTELGRIKPRGDTGLTAKNQRLLSRAIRRARA 151 Query: 134 IGLMSKVHKDI 144 G+M +K + Sbjct: 152 AGIMPTKYKSV 162 >Hs22055525 [J] KOG3162 Mitochondrial/chloroplast ribosomal protein S18 Length = 157 Score = 50.8 bits (120), Expect = 7e-07 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 92 YTNPEFLSRFVTS-TGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKDISVL 147 Y N + LS+FV+ TG I R VTGL K Q+ +TKAIKR Q +G M +KD + L Sbjct: 89 YKNAQLLSQFVSPFTGCIYGRHVTGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYL 145 >Hs7705630 [J] KOG3162 Mitochondrial/chloroplast ribosomal protein S18 Length = 142 Score = 50.1 bits (118), Expect = 1e-06 Identities = 27/57 (47%), Positives = 36/57 (62%), Gaps = 1/57 (1%) Query: 92 YTNPEFLSRFVTS-TGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKDISVL 147 Y N + LS+FV+ TG I R +TGL K Q+ +TKAIKR Q +G M +KD + L Sbjct: 74 YKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYL 130 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,128,261 Number of Sequences: 60738 Number of extensions: 374250 Number of successful extensions: 904 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 901 Number of HSP's gapped (non-prelim): 4 length of query: 155 length of database: 30,389,216 effective HSP length: 97 effective length of query: 58 effective length of database: 24,497,630 effective search space: 1420862540 effective search space used: 1420862540 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)