ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV1190 suspect: LH R KOG0255 General function prediction only Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV1190 417851 417354 -166 
         (166 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YPR156c [R] KOG0255 Synaptic vesicle transporter SVOP and relate... 48 7e-06 >YPR156c [R] KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) Length = 622 Score = 47.8 bits (112), Expect = 7e-06 Identities = 33/98 (33%), Positives = 53/98 (53%), Gaps = 14/98 (14%) Query: 29 QSSPLSKISTTQEVEDYV------KDNVQKGE-----TDSIDSLKATNLDLSKKAIPGFN 77 ++S LS + + Q+ + Y+ K N+ + T+++ SL+ + SK +P N Sbjct: 14 ETSSLSDVES-QQPQQYIPSESGSKSNMAPNQLKLTRTETVKSLQDMGVS-SKAPVPDVN 71 Query: 78 QP-IAEGAEFPEEYEIETRTGLVKVATLHQLNRLDTRV 114 P ++ FPEEY +ET TGLV VATLH + R T + Sbjct: 72 APQSSKNKIFPEEYTLETPTGLVPVATLHSIGRTSTAI 109 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.311 0.131 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,844,517 Number of Sequences: 60738 Number of extensions: 253395 Number of successful extensions: 640 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 640 Number of HSP's gapped (non-prelim): 1 length of query: 166 length of database: 30,389,216 effective HSP length: 98 effective length of query: 68 effective length of database: 24,436,892 effective search space: 1661708656 effective search space used: 1661708656 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)