ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV1616 suspect: LH S KOG3856 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV1616 569076  569420 115  
         (115 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YJR082c [S] KOG3856 Uncharacterized conserved protein 59 1e-09 >YJR082c [S] KOG3856 Uncharacterized conserved protein Length = 113 Score = 58.9 bits (141), Expect = 1e-09 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 24/100 (24%) Query: 16 RDALVQKKQLEAKWNSLEQEVYDKETEYLSQKPSSR--------------MGNILLGFQG 61 + +L +++ E +++L+QE+YDKETEY S ++ GNI+ GF Sbjct: 16 KKSLQDRREQEDTFDNLQQEIYDKETEYFSHNSNNNHSGHGGAHGSKSHYSGNIIKGFDT 75 Query: 62 FNKSSSAQQILSDHSHSSNAQPLDDNDRIFSLSSYLFAKQ 101 F+K S HSH+ +A ++NDRIFSLSS + KQ Sbjct: 76 FSK--------SHHSHADSA--FNNNDRIFSLSSATYVKQ 105 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.307 0.122 0.324 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,795,112 Number of Sequences: 60738 Number of extensions: 204924 Number of successful extensions: 620 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 618 Number of HSP's gapped (non-prelim): 1 length of query: 115 length of database: 30,389,216 effective HSP length: 91 effective length of query: 24 effective length of database: 24,862,058 effective search space: 596689392 effective search space used: 596689392 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)