ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV1711.1 suspect: Pn K KOG1831 Transcription Negative regulator of transcription

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV1711.1 603533 603408 -42  
         (42 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7303881 [K] KOG1831 Negative regulator of transcription 28 1.9 Hs20556995 [WV] KOG1216 von Willebrand factor and related coagul... 27 5.4 CE14096 [A] KOG1588 RNA-binding protein Sam68 and related KH dom... 27 7.1 >7303881 [K] KOG1831 Negative regulator of transcription Length = 1766 Score = 28.5 bits (62), Expect = 1.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Query: 4 PKTLAIPSPTAKTLPVSFKLDSSETPLILSSKI 36 P+ + +P P L V DSS P +LSS I Sbjct: 1516 PRNMRLPDPFTPNLKVDMLSDSSNAPKVLSSYI 1548 >Hs20556995 [WV] KOG1216 von Willebrand factor and related coagulation proteins Length = 880 Score = 26.9 bits (58), Expect = 5.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 9 IPSPTAKTLPVSFKLDSSETPLILSSKIEETSV 41 +P+ TA T+P S + ++ TP +L S + SV Sbjct: 4 MPTATASTVPSSSTVGTTRTPAVLPSSLPTFSV 36 >CE14096 [A] KOG1588 RNA-binding protein Sam68 and related KH domain proteins Length = 463 Score = 26.6 bits (57), Expect = 7.1 Identities = 14/41 (34%), Positives = 20/41 (48%) Query: 1 MFKPKTLAIPSPTAKTLPVSFKLDSSETPLILSSKIEETSV 41 MF PK+ +I SPT P+S+ S + L + E V Sbjct: 103 MFNPKSRSIFSPTLPATPMSYGKSSMDKSLFSPTATEPIEV 143 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.308 0.126 0.332 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,246,459 Number of Sequences: 60738 Number of extensions: 52572 Number of successful extensions: 118 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 115 Number of HSP's gapped (non-prelim): 3 length of query: 42 length of database: 30,389,216 effective HSP length: 18 effective length of query: 24 effective length of database: 29,295,932 effective search space: 703102368 effective search space used: 703102368 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)