ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV1728.1 suspect: LH T KOG1187 Signal transduction mechanisms Serine/threonine protein kinase

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV1728.1 611650  611997 116  
         (116 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value At5g13290 [T] KOG1187 Serine/threonine protein kinase 27 3.5 >At5g13290 [T] KOG1187 Serine/threonine protein kinase Length = 401 Score = 27.3 bits (59), Expect = 3.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 39 STNVVSNTLLYVLFFFARVSGSSRAIGRPVK 69 S+N +S LL+ L FF+R S S+ R VK Sbjct: 12 SSNTISLLLLFFLVFFSRTSTSTSCRRRTVK 42 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.325 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,095,145 Number of Sequences: 60738 Number of extensions: 101020 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 217 Number of HSP's gapped (non-prelim): 1 length of query: 116 length of database: 30,389,216 effective HSP length: 92 effective length of query: 24 effective length of database: 24,801,320 effective search space: 595231680 effective search space used: 595231680 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits)