ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV2112 suspect: LH S KOG3808 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV2112 744741 744526 -72  
         (72 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7293589 [S] KOG3808 Uncharacterized conserved protein 85 2e-17 >7293589 [S] KOG3808 Uncharacterized conserved protein Length = 74 Score = 84.7 bits (208), Expect = 2e-17 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 1/65 (1%) Query: 2 SALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSLA 61 SALFNF SLL VILL IC+C Y+ + PSL+DR K +G +G FWK ARIGER SP+V A Sbjct: 4 SALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNK-TGFMGTFWKLARIGERKSPWVGAA 62 Query: 62 CIAMA 66 C+ MA Sbjct: 63 CLIMA 67 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.332 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,777,565 Number of Sequences: 60738 Number of extensions: 114026 Number of successful extensions: 314 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 312 Number of HSP's gapped (non-prelim): 1 length of query: 72 length of database: 30,389,216 effective HSP length: 48 effective length of query: 24 effective length of database: 27,473,792 effective search space: 659371008 effective search space used: 659371008 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits)