ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV2743 suspect: LH R KOG4197 General function prediction only FOG: PPR repeat

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV2743 951335  953893 853  
         (853 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value At1g77360 [R] KOG4197 FOG: PPR repeat 51 7e-06 >At1g77360 [R] KOG4197 FOG: PPR repeat Length = 481 Score = 51.2 bits (121), Expect = 7e-06 Identities = 25/82 (30%), Positives = 48/82 (58%), Gaps = 3/82 (3%) Query: 305 YDMQPNRKNYTTVISFYTKMEHYKKAWQLFDSLKFLSLEHKPDTKVYNLMLEVCQKEKNY 364 YD+ PN + ++S K ++ +KA ++F++++ PD+K Y+++LE KE N Sbjct: 161 YDLPPNLVAFNGLLSALCKSKNVRKAQEVFENMRD---RFTPDSKTYSILLEGWGKEPNL 217 Query: 365 ARSLDIFQEMDDLNVTKDLKTY 386 ++ ++F+EM D D+ TY Sbjct: 218 PKAREVFREMIDAGCHPDIVTY 239 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.133 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,472,402 Number of Sequences: 60738 Number of extensions: 1996791 Number of successful extensions: 7038 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7033 Number of HSP's gapped (non-prelim): 4 length of query: 853 length of database: 30,389,216 effective HSP length: 115 effective length of query: 738 effective length of database: 23,404,346 effective search space: 17272407348 effective search space used: 17272407348 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)