ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV3019 suspect: LH U KOG1091 Intracellular trafficking, secretion, and vesicular transport Ypt/Rab-specific GTPase-activating protein GYP6

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV3019 1049076  1049993 306  
         (306 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YJL044c [U] KOG1091 Ypt/Rab-specific GTPase-activating protein GYP6 79 8e-15 >YJL044c [U] KOG1091 Ypt/Rab-specific GTPase-activating protein GYP6 Length = 458 Score = 79.0 bits (193), Expect = 8e-15 Identities = 71/273 (26%), Positives = 126/273 (46%), Gaps = 53/273 (19%) Query: 4 SSNGNRFGIQKLEAHDVGNVDEHPLAIVNG--------------VSMMDSQEMIELDVAR 49 S+ + GI++L V V++HPL+ N +++ ++ E+I+LD++R Sbjct: 98 SNVSSSVGIRRLTP--VEAVEKHPLSDDNDKTKGSLSKGSDEKPLTLRETLEIIDLDLSR 155 Query: 50 LHSGQL-NGPQEENALRQILVNWV---KRNGVGYKQGMHEICLVLYLE-------NDKDV 98 + + P+ +RQ+L N++ + + YKQG HEI V+YL+ ++ D+ Sbjct: 156 IMLDDIFQEPKVHAQMRQLLYNYLLIHQSEHLQYKQGFHEILSVIYLQLYHGTDLDNTDL 215 Query: 99 DECYKRFDNVMKWLYPLFYRDSGVNEWIKNDFSPMLRKMSPRRLYEIIVV--------KF 150 F+ +M + P+FY + + W K F+ + R P ++ K Sbjct: 216 QNVLIIFNKLMNQIEPIFYNEENLINWDKRVFTKIFRICLPDLFSKVFYQPPKTGSGKKK 275 Query: 151 QISHAV-----WCIRWCRLLFIRELSGPDQY-LPIWYELFDIENK-GKFIACVTIVMLMC 203 + H + W IRW RLLF+REL P +Y L +W + FIAC I +L+ Sbjct: 276 NVDHLIHSNLIWLIRWTRLLFLREL--PLKYVLIVWDHVLTFNYPLDIFIACTIITLLLS 333 Query: 204 IVPQLTE---------AQDESECLYLLLNYPKL 227 I +L E + E + L+L++ K+ Sbjct: 334 IYDELHELVSQGDYEHTNNNDEFVELILHFKKI 366 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.322 0.139 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,951,490 Number of Sequences: 60738 Number of extensions: 892966 Number of successful extensions: 1941 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1939 Number of HSP's gapped (non-prelim): 1 length of query: 306 length of database: 30,389,216 effective HSP length: 106 effective length of query: 200 effective length of database: 23,950,988 effective search space: 4790197600 effective search space used: 4790197600 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)