ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV3050 suspect: LH I KOG1933 Lipid transport and metabolism Cholesterol transport protein (Niemann-Pick C disease protein)

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV3050 1055838  1059563 1242 
         (1242 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value SPBC3B9.15c [I] KOG1933 Cholesterol transport protein (Niemann-P... 54 2e-06 >SPBC3B9.15c [I] KOG1933 Cholesterol transport protein (Niemann-Pick C disease protein) Length = 1086 Score = 53.9 bits (128), Expect = 2e-06 Identities = 36/168 (21%), Positives = 73/168 (43%), Gaps = 16/168 (9%) Query: 244 IVSFFIYNMEHMKSVKSPFGISVAIIAQLILTLYTGKAVTCFFFKTSSDNIPWFLIYIPI 303 + ++ ++ + +++ FG++ I Q T Y +FF+ + PW + Y I Sbjct: 244 LFAYLYLSLVRLHDIRAKFGLTATIFIQSG-TAYFSTCSLLYFFERTGPICPWPMAYYII 302 Query: 304 MFASLSNLFKLTIEKKGTIFIEREPVFIQTSNDQTNTPPFLSSQQDFLNSMVKSNRDTLR 363 +F + N F+L + +R P I + F ++++ S L+ Sbjct: 303 IFMDIENSFRLLRAVIASPQTKRVPSRIM---------------EGFSSTIIASFSSLLK 347 Query: 364 TTLAMLILLVIITPFSRKVCCFFITALLTNLFLQITYFCAVLSLDHRR 411 L + +L + P ++ C F + + + L ++F AVLS+D RR Sbjct: 348 KLLTLFVLSFFVYPLVQEFCLFLACSFVVSFLLHGSFFLAVLSVDIRR 395 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.321 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,424,052 Number of Sequences: 60738 Number of extensions: 2726297 Number of successful extensions: 6564 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6560 Number of HSP's gapped (non-prelim): 4 length of query: 1242 length of database: 30,389,216 effective HSP length: 118 effective length of query: 1124 effective length of database: 23,222,132 effective search space: 26101676368 effective search space used: 26101676368 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits)