ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV3120 suspect: LH S KOG4624 Function unknown Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV3120 1083537  1083845 103  
         (103 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YKL137w [S] KOG4624 Uncharacterized conserved protein 111 2e-25 >YKL137w [S] KOG4624 Uncharacterized conserved protein Length = 103 Score = 111 bits (277), Expect = 2e-25 Identities = 50/98 (51%), Positives = 71/98 (72%), Gaps = 1/98 (1%) Query: 5 VGKHNQRLPIWVLNPTEEKEARQNLKKFAYAQCVEYVEAMVECSKIHGLKLFPACNEPRD 64 + KH+ RLPIWVL+P EE++AR+NLK Y +C +V+AM +C+K +G+K+FP C++ RD Sbjct: 2 ISKHSSRLPIWVLSPREEQQARKNLKTETYKKCANFVQAMADCAKANGMKVFPTCDKQRD 61 Query: 65 AMRKCILSYQKDSN-LDRQRDLIVERKIERLEDLLKKQ 101 M+ C+L YQ D LD +RD IV KI +LE L +KQ Sbjct: 62 EMKSCLLFYQTDEKYLDGERDKIVLEKINKLEKLCQKQ 99 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,508,471 Number of Sequences: 60738 Number of extensions: 246375 Number of successful extensions: 760 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 758 Number of HSP's gapped (non-prelim): 1 length of query: 103 length of database: 30,389,216 effective HSP length: 79 effective length of query: 24 effective length of database: 25,590,914 effective search space: 614181936 effective search space used: 614181936 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)