ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV3399 good R KOG4680 General function prediction only Uncharacterized conserved protein, contains ML domain

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV3399 1177801  1178319 173  
         (173 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDL046w [R] KOG4680 Uncharacterized conserved protein contains M... 203 1e-52 SPAPB8E5.04c [R] KOG4680 Uncharacterized conserved protein conta... 113 1e-25 At3g11780 [R] KOG4680 Uncharacterized conserved protein contains... 52 4e-07 >YDL046w [R] KOG4680 Uncharacterized conserved protein contains ML domain Length = 173 Score = 203 bits (516), Expect = 1e-52 Identities = 96/141 (68%), Positives = 113/141 (80%) Query: 31 PPSANKPIPGDSPLLQCDVDQSQSLDVTQVNLVPNPPQRGENLTIAAAGVLQTTIEEGAY 90 PP KPI G+SPL QCD+ Q +++ +VNL PNPP RGENLTI+A G + TIEEGAY Sbjct: 31 PPPNTKPINGESPLYQCDILDKQLVEIKEVNLDPNPPVRGENLTISANGEVFETIEEGAY 90 Query: 91 IDIEVRLGYIKLISQTYDLCEQLEENDIDGLKCPIEEGVYELNKIVEIPSEVPPGKYSVI 150 ID+EVRLGYI+L+SQT+DLCE LE+NDI+GL CPIE G Y + KIVEIP EVPPGKY V+ Sbjct: 91 IDVEVRLGYIRLLSQTFDLCETLEDNDIEGLSCPIEPGEYNIKKIVEIPGEVPPGKYVVV 150 Query: 151 ARAYNVDDEQITCLTGEVIFP 171 ARAY D+ ITCLTGEVIFP Sbjct: 151 ARAYTEKDDLITCLTGEVIFP 171 >SPAPB8E5.04c [R] KOG4680 Uncharacterized conserved protein contains ML domain Length = 188 Score = 113 bits (283), Expect = 1e-25 Identities = 52/140 (37%), Positives = 89/140 (63%), Gaps = 4/140 (2%) Query: 33 SANKPIPGDSPLLQC-DVDQSQS-LDVTQVNLVPNPPQRGENLTIAAAGVLQTTIEEGAY 90 S ++ IPG +P C D D+ + V +NL+PNPP G+NLTI + TT+ G+Y Sbjct: 39 STSEKIPGANPASYCADWDRGDDHVVVDYINLIPNPPAAGKNLTIETEINVGTTVLNGSY 98 Query: 91 IDIEVRLGYIKLISQTYDLCEQLEENDIDGLKCPIEEGVYELNKIVEIPSEVPPGKYSVI 150 +DI+V+ G+++++++ D+C++ E + ++CP+E G+ + +P +PPG+Y V+ Sbjct: 99 VDIQVKYGFVRIVNERLDICDKAYE--LAAVECPVEPGIITKQATISLPWAIPPGRYHVL 156 Query: 151 ARAYNVDDEQITCLTGEVIF 170 A AYN D EQ+TC++ V F Sbjct: 157 ATAYNADGEQLTCVSASVSF 176 >At3g11780 [R] KOG4680 Uncharacterized conserved protein contains ML domain Length = 153 Score = 52.0 bits (123), Expect = 4e-07 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 9/118 (7%) Query: 47 CDVDQSQSLDVTQVNLVPNPPQRGENLTIAAAGVLQTTIEEGAYIDIEVRLGYIKLISQT 106 CD ++ + V V++ P P RGE T + T I G + IEV + S+T Sbjct: 30 CDNNEEYEVKVQGVDITPYPIARGEPATFRISANTDTEISSGKLV-IEVSYFGWHIHSET 88 Query: 107 YDLCEQLEENDIDGLKCPIEEGVYELNKIVEIPSEVPPGKYSVIARAYNVDDEQITCL 164 +DLC++ CP+ G + + +P PPG YS+ + + +++TC+ Sbjct: 89 HDLCDETS--------CPVAIGDFLVAHSQVLPGYTPPGSYSLKMKMLDGRKKELTCI 138 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.315 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,505,414 Number of Sequences: 60738 Number of extensions: 450224 Number of successful extensions: 900 Number of sequences better than 1.0e-05: 3 Number of HSP's better than 0.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 896 Number of HSP's gapped (non-prelim): 3 length of query: 173 length of database: 30,389,216 effective HSP length: 99 effective length of query: 74 effective length of database: 24,376,154 effective search space: 1803835396 effective search space used: 1803835396 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)