ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV3930 suspect: LH R KOG0017 General function prediction only FOG: Transposon-encoded proteins with TYA, reverse transcriptase, integrase domains in various combinations

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV3930 1357782  1359467 562  
         (562 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs8923124 [R] KOG0017 FOG: Transposon-encoded proteins with TYA ... 50 7e-06 >Hs8923124 [R] KOG0017 FOG: Transposon-encoded proteins with TYA reverse transcriptase integrase domains in various combinations Length = 392 Score = 50.4 bits (119), Expect = 7e-06 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 9/111 (8%) Query: 272 ERLIYYLEHGEYPPSCNRNEKARLRVIAKKHSLINGKLHFKGKE------VVYDPQRQLR 325 +++ YY GEY + +E++ +R AKK KL + GK+ V+ + + + Sbjct: 13 KQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKK 72 Query: 326 IAYETHMVD---HQGINRVTSKLAEKYHWKGIKQTVIQVINSCSNCQENTN 373 + E H D H GI+R + + Y+W + Q + +C +CQ N Sbjct: 73 VLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDAKQWVYACQHCQVAKN 123 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.316 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,147,003 Number of Sequences: 60738 Number of extensions: 1616773 Number of successful extensions: 3871 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3870 Number of HSP's gapped (non-prelim): 1 length of query: 562 length of database: 30,389,216 effective HSP length: 112 effective length of query: 450 effective length of database: 23,586,560 effective search space: 10613952000 effective search space used: 10613952000 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)