ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV4256 suspect: LH A KOG1784 RNA processing and modification Small Nuclear ribonucleoprotein splicing factor

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV4256 1468048 1467761 -96  
         (96 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YJR022w [A] KOG1784 Small Nuclear ribonucleoprotein splicing factor 53 8e-08 >YJR022w [A] KOG1784 Small Nuclear ribonucleoprotein splicing factor Length = 128 Score = 52.8 bits (125), Expect = 8e-08 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 13/108 (12%) Query: 1 MSALLKDYLDKKVMLVNVDGDTYYGEMKGFDHAGNMIL------LKDSKIC---IIRSSE 51 MSA LKDYL+K+V+++ VDG+ + GFD N+ + + IC ++R SE Sbjct: 20 MSATLKDYLNKRVVIIKVDGECLIASLNGFDKNTNLFITNVFNRISKEFICKAQLLRGSE 79 Query: 52 VVLCGLIDDIPEEKELAKL--QKFPACKN-KLPFKEEIDIWSERWANR 96 + L GLI D + LA + +K P K+ K + E IW + + ++ Sbjct: 80 IALVGLI-DAENDDSLAPIDEKKVPMLKDTKNKIENEHVIWEKVYESK 126 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.320 0.140 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,261,006 Number of Sequences: 60738 Number of extensions: 232305 Number of successful extensions: 617 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 616 Number of HSP's gapped (non-prelim): 1 length of query: 96 length of database: 30,389,216 effective HSP length: 72 effective length of query: 24 effective length of database: 26,016,080 effective search space: 624385920 effective search space used: 624385920 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)