ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV4776 suspect: LH C KOG1352 Energy production and conversion Vacuolar H+-ATPase V1 sector, subunit A

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV4776 1640343 1639936 -136 
         (136 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YDL185w [C] KOG1352 Vacuolar H+-ATPase V1 sector subunit A 52 3e-07 >YDL185w [C] KOG1352 Vacuolar H+-ATPase V1 sector subunit A Length = 1071 Score = 51.6 bits (122), Expect = 3e-07 Identities = 27/82 (32%), Positives = 47/82 (56%), Gaps = 1/82 (1%) Query: 4 AAGTLVFMADGSLKPIEDVTIEEEVLSSDGSANFVQSIINCHERMFEITQLSPHRAHKNK 63 A GT V MADGS++ IE++ + +V+ DG V + E M+ + Q S HRAHK+ Sbjct: 286 AKGTNVLMADGSIECIENIEVGNKVMGKDGRPREVIKLPRGRETMYSVVQKSQHRAHKS- 344 Query: 64 DVNFASFDMIRLRCSGSQALML 85 D + ++++ C+ + L++ Sbjct: 345 DSSREVPELLKFTCNATHELVV 366 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.325 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,215,864 Number of Sequences: 60738 Number of extensions: 252001 Number of successful extensions: 730 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 729 Number of HSP's gapped (non-prelim): 1 length of query: 136 length of database: 30,389,216 effective HSP length: 95 effective length of query: 41 effective length of database: 24,619,106 effective search space: 1009383346 effective search space used: 1009383346 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits)