ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV5343.1 suspect: LH D KOG0798 Cell cycle control, cell division, chromosome partitioning Uncharacterized conserved protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV5343.1 1827818 1827621 -66  
         (66 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value CE18037 [D] KOG0798 Uncharacterized conserved protein 27 6.7 At2g03120 [S] KOG2443 Uncharacterized conserved protein 26 8.8 >CE18037 [D] KOG0798 Uncharacterized conserved protein Length = 517 Score = 26.6 bits (57), Expect = 6.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Query: 31 TALYSTPYFSSSEVMMMSRTFNSSTMYFFNASMSF 65 T + T FS SEV++ F+ FFN S+ F Sbjct: 294 TKIVKTENFSFSEVLLFFSVFSGKKTEFFNFSVVF 328 >At2g03120 [S] KOG2443 Uncharacterized conserved protein Length = 344 Score = 26.2 bits (56), Expect = 8.8 Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 12 SLTFLASFFNFLPNTGQSATALYSTPYFSSSEV 44 S T L + FLPN ++ PYF S EV Sbjct: 103 SATLLPAIRRFLPNPWNDNLIVWRFPYFKSLEV 135 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.325 0.127 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,172,347 Number of Sequences: 60738 Number of extensions: 82657 Number of successful extensions: 290 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 287 Number of HSP's gapped (non-prelim): 3 length of query: 66 length of database: 30,389,216 effective HSP length: 42 effective length of query: 24 effective length of database: 27,838,220 effective search space: 668117280 effective search space used: 668117280 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits)