ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV5424 suspect: LH R KOG0510 General function prediction only Ankyrin repeat protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV5424 1855323 1852525 -933 
         (933 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value 7298956 [R] KOG0510 Ankyrin repeat protein 56 3e-07 >7298956 [R] KOG0510 Ankyrin repeat protein Length = 914 Score = 55.8 bits (133), Expect = 3e-07 Identities = 50/194 (25%), Positives = 88/194 (44%), Gaps = 25/194 (12%) Query: 448 LPEALYRPPSNLDINFLIDDQGHTSLHWAVAMSNIPLIRVLLVQDADLLRCNDKGFNCLT 507 L L P ++ ++ I ++ T+LH A N+ + +LL + AD N +GF L Sbjct: 228 LEALLNAPNADANVRICIREKESTALHLAADEGNVECVDLLLAKGADAKLKNHRGFTPLH 287 Query: 508 KSVFYNNCYKAVSFQQIISML---NPCLVTPDANHRLPLHYLVELTVNRSKEPHVIEYYM 564 + + S + S+L N D +HR PLH V +S+ + I M Sbjct: 288 LAA------RTSSLDCVESLLRNGNADANAEDFDHRTPLH----AAVGKSENAYDI---M 334 Query: 565 DTILDTLAKEDEKLLRMSLNHQDTLGNTPLHLAALNKNVDLCQKLVYFGASPDILNGENQ 624 +T++ A ++NH+D G T LHLAAL+ V + L++ GA + + Sbjct: 335 ETLIQWGA---------NVNHKDIYGFTALHLAALDGLVQCVEMLIFHGADVTTKSKKGT 385 Query: 625 TVSMILSRFTVPNI 638 + +++R T ++ Sbjct: 386 SALNVITRKTPASV 399 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.130 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,336,226 Number of Sequences: 60738 Number of extensions: 2005712 Number of successful extensions: 6327 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6322 Number of HSP's gapped (non-prelim): 2 length of query: 933 length of database: 30,389,216 effective HSP length: 116 effective length of query: 817 effective length of database: 23,343,608 effective search space: 19071727736 effective search space used: 19071727736 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)