ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV5529    suspect: LH   S     KOG4764  Function unknown                                               Uncharacterized conserved protein

BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV5529 1895812 1895621 -64  
         (64 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR363w-a [S] KOG4764 Uncharacterized conserved protein                57   4e-09

>YDR363w-a [S] KOG4764 Uncharacterized conserved protein
          Length = 89

 Score = 57.4 bits (137), Expect = 4e-09
 Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 3  NKEPRKSSLXXXXXXXXXPADSWPS-QPVSQDLTKDSNLWAEDWDDIEVEDDFTKELKKE 61
          N+E  K SL         P D+W + + +  +    +N+W E+WDD+EV+DDFT ELK E
Sbjct: 21 NEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAE 80

Query: 62 LE 63
          L+
Sbjct: 81 LD 82


  Database: KOG eukaryal database 04/03
    Posted date:  Apr 14, 2003  1:07 PM
  Number of letters in database: 30,389,216
  Number of sequences in database:  60,738
  
Lambda     K      H
   0.302    0.124    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,746,556
Number of Sequences: 60738
Number of extensions: 118753
Number of successful extensions: 240
Number of sequences better than 1.0e-05: 1
Number of HSP's better than  0.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 239
Number of HSP's gapped (non-prelim): 1
length of query: 64
length of database: 30,389,216
effective HSP length: 40
effective length of query: 24
effective length of database: 27,959,696
effective search space: 671032704
effective search space used: 671032704
T: 11
A: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)