ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactV6035 suspect: LH S KOG0858 Function unknown Predicted membrane protein

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactV6035 2072720 2072154 -189 
         (189 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YBR201w [S] KOG0858 Predicted membrane protein 76 3e-14 >YBR201w [S] KOG0858 Predicted membrane protein Length = 211 Score = 75.9 bits (185), Expect = 3e-14 Identities = 52/192 (27%), Positives = 91/192 (47%), Gaps = 3/192 (1%) Query: 1 MDLIRDIPIITRCWGIGILMLNLALWCNFLTVYDVAYSWDAVYYRKQYLRLIYGLF-YIK 59 ++L+ DIP++TR W IG L+L+ + V YS+D V+ + QY RL+Y +F Y Sbjct: 6 LNLLGDIPLVTRLWTIGCLVLSGLTSLRIVDPGKVVYSYDLVFKKGQYGRLLYSIFDYGA 65 Query: 60 LSPDLIGNAVVALSSLQLIEQTTTDKRKLALKILCLYLSVVFFIVYSDLPLSIGQALGIN 119 + + N V+ + L +E + +RK I L + +V S+G L N Sbjct: 66 FNWISMINIFVSANHLSTLENSFNLRRKFCWIIFLLLVILVKMTSIEQPAASLGVLLHEN 125 Query: 120 MWYYVSKKSXXXXXXXXXXXXXXX--WIPISSIALIYLLTPLELRQALALIIPGHLLYFI 177 + YY KK+ PI A++Y + + +PGH++Y++ Sbjct: 126 LVYYELKKNGNQMNVRFFGAIDVSPSIFPIYMNAVMYFVYKRSWLEIAMNFMPGHVIYYM 185 Query: 178 DEAMSKTYGLNI 189 D+ + K YG+++ Sbjct: 186 DDIIGKIYGIDL 197 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.330 0.146 0.452 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,332,880 Number of Sequences: 60738 Number of extensions: 313533 Number of successful extensions: 855 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 852 Number of HSP's gapped (non-prelim): 1 length of query: 189 length of database: 30,389,216 effective HSP length: 100 effective length of query: 89 effective length of database: 24,315,416 effective search space: 2164072024 effective search space used: 2164072024 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits)