ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI0466 suspect: LH U KOG4809 Intracellular trafficking, secretion, and vesicular transport Rab6 GTPase-interacting protein involved in endosome-to-TGN transport

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI0466  158672 156612 -687 
         (687 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs14149661 [U] KOG4809 Rab6 GTPase-interacting protein involved ... 52 3e-06 >Hs14149661 [U] KOG4809 Rab6 GTPase-interacting protein involved in endosome-to-TGN transport Length = 948 Score = 52.0 bits (123), Expect = 3e-06 Identities = 44/201 (21%), Positives = 87/201 (42%), Gaps = 25/201 (12%) Query: 490 SLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNE 549 SLA LK +S + LE+ E KE E ++ QL+K +E Sbjct: 656 SLASSGLKKDSRLKTLEIALEQKKE---------------------ECLKMESQLKKAHE 694 Query: 550 IEMLRN---KLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEA 606 + +++ + L+ +RY+++S + +D+L E +EN + + I+E Sbjct: 695 AALEARASPEMSDRIQHLEREITRYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAEL 754 Query: 607 ELVWFKSIKNQVLKFNNYVHLTN-KLREELEFLDTQLRSTTKGDDFFSELEFSSLQQMLL 665 E + + +K+Q K N H + ++ + L+ R +D +L+ L + Sbjct: 755 ESLTSRQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQVEELLMAME 814 Query: 666 NDKKVINSCMNELSASIEDLA 686 K+ + S +LS++ + LA Sbjct: 815 KVKQELESMKAKLSSTQQSLA 835 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,403,070 Number of Sequences: 60738 Number of extensions: 1788253 Number of successful extensions: 7028 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7024 Number of HSP's gapped (non-prelim): 3 length of query: 687 length of database: 30,389,216 effective HSP length: 113 effective length of query: 574 effective length of database: 23,525,822 effective search space: 13503821828 effective search space used: 13503821828 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)