ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI0505 good L KOG1658 Replication, recombination and repair DNA polymerase epsilon, subunit C

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI0505  170883  171380 166  
         (166 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YJL065c [L] KOG1658 DNA polymerase epsilon subunit C 78 6e-15 YBR278w [L] KOG1658 DNA polymerase epsilon subunit C 77 8e-15 SPAC17G8.03c [K] KOG1659 Class 2 transcription repressor NC2 alp... 50 2e-06 Hs9845281 [L] KOG1658 DNA polymerase epsilon subunit C 48 7e-06 >YJL065c [L] KOG1658 DNA polymerase epsilon subunit C Length = 167 Score = 77.8 bits (190), Expect = 6e-15 Identities = 42/107 (39%), Positives = 62/107 (57%), Gaps = 8/107 (7%) Query: 9 PRIPISKCKKIARTDPEYILTSQXXXXXXXXXXELFIQMLAEETCSLAQIHKQTKT---- 64 P++P+ K ++IA+ DPEY+ TS E F+Q+L E+ Q +Q + Sbjct: 18 PKLPVEKVQRIAKNDPEYMDTSDDAFVATAFATEFFVQVLTHESLHRQQQQQQQQVPPLP 77 Query: 65 --LRLNYEDLSTAIRNLD--KFQFLSDVVPQTENLASLVRENKVRYT 107 L L+Y+D+S AI + QFL+DV+P T+NL LV EN+VRYT Sbjct: 78 DELTLSYDDISAAIVHSSDGHLQFLNDVIPTTKNLRLLVEENRVRYT 124 >YBR278w [L] KOG1658 DNA polymerase epsilon subunit C Length = 201 Score = 77.4 bits (189), Expect = 8e-15 Identities = 39/101 (38%), Positives = 59/101 (57%), Gaps = 1/101 (0%) Query: 5 KSKLPRIPISKCKKIARTDPEYILTSQXXXXXXXXXXELFIQMLAEETCSLAQIHKQTKT 64 K K P PISK KKIA+ DPEY++TS ELF+Q L EE+ LAQ++ + KT Sbjct: 6 KEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQLNSKGKT 65 Query: 65 -LRLNYEDLSTAIRNLDKFQFLSDVVPQTENLASLVRENKV 104 LRL+ + + D F+FL D + Q + ++L ++ ++ Sbjct: 66 SLRLSLNSIEECVEKRDNFRFLEDAIKQLKKNSALDKKREL 106 >SPAC17G8.03c [K] KOG1659 Class 2 transcription repressor NC2 alpha subunit (DRAP1) Length = 199 Score = 49.7 bits (117), Expect = 2e-06 Identities = 24/96 (25%), Positives = 49/96 (51%), Gaps = 3/96 (3%) Query: 10 RIPISKCKKIARTDPEYILTSQXXXXXXXXXXELFIQMLAEETCSLAQIHKQTKTLRLNY 69 R P+++ KKI + D + +Q ELF+Q + +E+C ++H + R+ Sbjct: 23 RFPVARIKKIMQADQDVGKVAQVTPVIMSKALELFMQSIIQESCKQTRLH---QAKRVTV 79 Query: 70 EDLSTAIRNLDKFQFLSDVVPQTENLASLVRENKVR 105 L A++++++F FL D+V + + + E K + Sbjct: 80 SHLKHAVQSVEQFDFLQDIVEKVPDAPPIKAERKTK 115 >Hs9845281 [L] KOG1658 DNA polymerase epsilon subunit C Length = 117 Score = 47.8 bits (112), Expect = 7e-06 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Query: 6 SKLPRIPISKCKKIARTDPEYILTSQXXXXXXXXXXELFIQMLAEETCSLAQIHKQTKTL 65 ++L R+P+++ K + + DP+ L Q ELF++ +A++ AQ Q K Sbjct: 36 ARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQ---QGKRK 92 Query: 66 RLNYEDLSTAIRNLDKFQFL 85 L DL AI +D+F FL Sbjct: 93 TLQRRDLDNAIEAVDEFAFL 112 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.129 0.351 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,366,134 Number of Sequences: 60738 Number of extensions: 159331 Number of successful extensions: 336 Number of sequences better than 1.0e-05: 4 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 332 Number of HSP's gapped (non-prelim): 4 length of query: 166 length of database: 30,389,216 effective HSP length: 98 effective length of query: 68 effective length of database: 24,436,892 effective search space: 1661708656 effective search space used: 1661708656 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)