ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI0551 suspect: LH J KOG4756 Translation, ribosomal structure and biogenesis Mitochondrial ribosomal protein L27

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI0551  185846  186280 145  
         (145 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value YBR282w [J] KOG4756 Mitochondrial ribosomal protein L27 183 6e-47 >YBR282w [J] KOG4756 Mitochondrial ribosomal protein L27 Length = 146 Score = 183 bits (465), Expect = 6e-47 Identities = 86/146 (58%), Positives = 108/146 (73%), Gaps = 1/146 (0%) Query: 1 MKPTSARFFQQSQITQLTRPWKKYRDGTLFYGASKVGNKRVPLTTKDGNKSMYKGTRSSG 60 MK + F ++ I LTRPWKKYRDG LFYG SKVGNKRVPLTTK GNK+MYKGTR+SG Sbjct: 1 MKGSPISQFSKTSINALTRPWKKYRDGELFYGLSKVGNKRVPLTTKQGNKTMYKGTRASG 60 Query: 61 IGRHTQYGGYKINWNRVRTYTVPKDFNTDLKPLLSHNLPELKHQFSGYQKGYTDPKLYFD 120 IGRHT++GGY INW +VRTY P N +LKP ++ N+P LKH+F G+ G DP+L Sbjct: 61 IGRHTKFGGYVINWKKVRTYVTPDMVNFELKPYVNANVPPLKHEFKGFSGGPLDPRLQLL 120 Query: 121 KLKKYVKEGKIQSE-ASNVESYVERG 145 K+K+Y+ G++QSE A++ Y ERG Sbjct: 121 KIKEYIVNGRVQSEGATDTSCYKERG 146 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.314 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,417,175 Number of Sequences: 60738 Number of extensions: 410275 Number of successful extensions: 697 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 696 Number of HSP's gapped (non-prelim): 1 length of query: 145 length of database: 30,389,216 effective HSP length: 96 effective length of query: 49 effective length of database: 24,558,368 effective search space: 1203360032 effective search space used: 1203360032 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)