ORF      STATUS       Function Best COG  Functional category                                          Pathways and functional systems
r_klactVI0841 suspect: LH OT KOG4041 Posttranslational modification, protein turnover, chaperones Protein phosphatase 1, regulatory (inhibitor) subunit PPP1R2 r_klactVI0841 suspect: LH OT KOG4041 Signal transduction mechanisms Protein phosphatase 1, regulatory (inhibitor) subunit PPP1R2

Only best alignment is shown:
BLASTP 2.2.3 [May-13-2002]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= r_klactVI0841  287169 286588 -194 
         (194 letters)

Database: KOG eukaryal database 04/03 
           60,738 sequences; 30,389,216 total letters

Searching..................................................done

Color Key for Alignment Scores:   
Score E Sequences producing significant alignments: (bits) Value Hs5453946 [OT] KOG4041 Protein phosphatase 1 regulatory (inhibit... 49 3e-06 >Hs5453946 [OT] KOG4041 Protein phosphatase 1 regulatory (inhibitor) subunit PPP1R2 Length = 205 Score = 49.3 bits (116), Expect = 3e-06 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 26/146 (17%) Query: 63 EQDPESLKWNKKN-LEENEITKQEFGDIHIDEPKTPYQGAVDPNGEYYKIDDDDEDLGGF 121 E +S KW++ N L +++G + IDEP TPY + + + + E + Sbjct: 39 ELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPD 98 Query: 122 SLG---------EPQVDLKEDKEPVTLLNNEDPQVSPPVLETEEDEAAKKHRKFEEMRKK 172 L EP+ ++E + ED +SP E +K R+FE RK Sbjct: 99 ILARKLAAAEGLEPKYRIQEQESS----GEEDSDLSP--------EEREKKRQFEMKRKL 146 Query: 173 HYNVKADLQNAKQ----NLPDDDDDE 194 HYN +++ A+Q +L DDD+DE Sbjct: 147 HYNEGLNIKLARQLISKDLHDDDEDE 172 Database: KOG eukaryal database 04/03 Posted date: Apr 14, 2003 1:07 PM Number of letters in database: 30,389,216 Number of sequences in database: 60,738 Lambda K H 0.305 0.130 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,975,754 Number of Sequences: 60738 Number of extensions: 691351 Number of successful extensions: 2160 Number of sequences better than 1.0e-05: 1 Number of HSP's better than 0.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2158 Number of HSP's gapped (non-prelim): 1 length of query: 194 length of database: 30,389,216 effective HSP length: 101 effective length of query: 93 effective length of database: 24,254,678 effective search space: 2255685054 effective search space used: 2255685054 T: 11 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)